PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000140.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 282aa    MW: 31967.4 Da    PI: 8.6571
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000140.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.46.8e-54101351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL+++++++++++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra+ sgyWkat
  Itr_sc000140.1_g00008.1  10 LPPGFRFHPTDEELIMYYLRNQATSRPCPV-SIIPEVDVYKFDPWELPEKAEFGENEWYFFTPRDRKYPNGVRPNRAAVSGYWKAT 94 
                              79****************************.89***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+++s +++ vg+kk Lvfykgr pkg ktdW+mheyrl
  Itr_sc000140.1_g00008.1  95 GTDKAIYS-GSKYVGVKKALVFYKGRPPKGIKTDWIMHEYRL 135
                              ********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-667162IPR003441NAC domain
PROSITE profilePS5100561.29510162IPR003441NAC domain
PfamPF023651.3E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MVGGKQTSDL PPGFRFHPTD EELIMYYLRN QATSRPCPVS IIPEVDVYKF DPWELPEKAE  60
FGENEWYFFT PRDRKYPNGV RPNRAAVSGY WKATGTDKAI YSGSKYVGVK KALVFYKGRP  120
PKGIKTDWIM HEYRLSESRA LPARQNGSMR LDDWVLCRIY KKKNLGKANN TGMMMMKTEV  180
EETNPQLIAS CSSEGGPQVQ GMKLPRACSL THLLEMDCFG SISQLLGDNN NINATFDNQN  240
PTLMTNNNGI VPFGLGEVVP HQYSQNSIFN QPIFVNPAFQ FQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-721016417167NAC domain-containing protein 19
4dul_A1e-721016417167NAC domain-containing protein 19
1ut7_B1e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_A1e-721016417167NO APICAL MERISTEM PROTEIN
1ut4_B1e-721016417167NO APICAL MERISTEM PROTEIN
1ut4_A1e-721016417167NO APICAL MERISTEM PROTEIN
3swp_D1e-721016420170NAC domain-containing protein 19
3swp_C1e-721016420170NAC domain-containing protein 19
3swp_B1e-721016420170NAC domain-containing protein 19
3swp_A1e-721016420170NAC domain-containing protein 19
3swm_D1e-721016420170NAC domain-containing protein 19
3swm_C1e-721016420170NAC domain-containing protein 19
3swm_B1e-721016420170NAC domain-containing protein 19
3swm_A1e-721016420170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6391460.0AB639146.1 Ipomoea nil InNAP mRNA for transcription factor InNAP, complete cds, cultivar: Violet.
GenBankAB6391470.0AB639147.1 Ipomoea nil InNAP mRNA for transcription factor InNAP, complete cds, cultivar: Peking Tendan.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598866.11e-146PREDICTED: NAC transcription factor 29-like
RefseqXP_016492232.11e-146PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-114NAC29_ARATH; NAC transcription factor 29
TrEMBLX5HYE60.0X5HYE6_IPONI; Transcription factor InNAP
STRINGPGSC0003DMT4000073411e-143(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-115NAC-like, activated by AP3/PI